SCOPe 2.07: Domain d1xo0b1: 1xo0 B:20-129

Lineage for d1xo0b1 (1xo0 B:20-129)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d1xo0b1: 1xo0 B:20-129 [115676]
   Other proteins in same PDB: d1xo0a2, d1xo0b2
   protein/DNA complex

Details for d1xo0b1

PDB Entry: 1xo0, 2 Å

PDB Description: high resolution structure of the holliday junction intermediate in cre-loxp site-specific recombination

PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d1xo0b1:

Sequence; same for both SEQRES and ATOM records:

>d1xo0b1 a.60.9.1 (B:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d1xo0b1:

• d1xo0b1 first appeared in SCOP 1.71
  
• d1xo0b1 appears in SCOPe 2.06
  
• d1xo0b1 appears in the current release, SCOPe 2.08