Lineage for d1xnza_ (1xnz A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732939Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 732940Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 732941Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 732993Protein Methionine aminopeptidase [55924] (5 species)
  7. 733002Species Escherichia coli [TaxId:562] [55925] (29 PDB entries)
  8. 733010Domain d1xnza_: 1xnz A: [115673]
    complexed with fcd, mn, na

Details for d1xnza_

PDB Entry: 1xnz (more details), 1.52 Å

PDB Description: Crystal Structure of Mn(II) form of E. coli. Methionine Aminopeptidase in complex with 5-(2-chlorophenyl)furan-2-carboxylic acid
PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d1xnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnza_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
aisiktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclg
yhgypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptim
gerlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheep
qvlhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvt
dngceiltlrkddtipaiishd

SCOP Domain Coordinates for d1xnza_:

Click to download the PDB-style file with coordinates for d1xnza_.
(The format of our PDB-style files is described here.)

Timeline for d1xnza_: