Lineage for d1xnyb1 (1xny B:10-267)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1835938Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1836040Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)
  7. 1836054Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)
    Uniprot Q9X4K7
  8. 1836069Domain d1xnyb1: 1xny B:10-267 [115671]
    complexed with 191, btn

Details for d1xnyb1

PDB Entry: 1xny (more details), 2.2 Å

PDB Description: biotin and propionyl-coa bound to acyl-coa carboxylase beta subunit from s. coelicolor (pccb)
PDB Compounds: (B:) propionyl-CoA carboxylase complex B subunit

SCOPe Domain Sequences for d1xnyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnyb1 c.14.1.4 (B:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]}
dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
yvkqllsylpsnnlsepp

SCOPe Domain Coordinates for d1xnyb1:

Click to download the PDB-style file with coordinates for d1xnyb1.
(The format of our PDB-style files is described here.)

Timeline for d1xnyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xnyb2