SCOP 1.71: Domain d1xnya2: 1xny A:268-530

Lineage for d1xnya2 (1xny A:268-530)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (4 proteins)
   Pfam 01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)

8. Domain d1xnya2: 1xny A:268-530 [115670]

Details for d1xnya2

PDB Entry: 1xny, 2.2 Å

PDB Description: biotin and propionyl-coa bound to acyl-coa carboxylase beta subunit from s. coelicolor (pccb)

SCOP Domain Sequences for d1xnya2:

Sequence; same for both SEQRES and ATOM records:

>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor}
afpeeadlavtdedaeldtivpdsanqpydmhsviehvlddaeffetqplfapniltgfg
rvegrpvgivanqpmqfagclditasekaarfvrtcdafnvpvltfvdvpgflpgvdqeh
dgiirrgaklifayaeatvplitvitrkafggaydvmgskhlgadlnlawptaqiavmga
qgavnilhrrtiadagddaeatrarliqeyedallnpytaaergyvdavimpsdtrrhiv
rglrqlrtkreslppkkhgnipl

Timeline for d1xnya2:

• d1xnya2 is new in SCOP 1.71
  
• d1xnya2 appears in SCOP 1.73
  
• d1xnya2 appears in the current release, SCOPe 2.08