SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1xnxb_ (1xnx B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 protein domains)
  6. 543539Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 543545Species Mouse (Mus musculus) [TaxId:10090] [117015] (2 PDB entries)
  8. 543547Domain d1xnxb_: 1xnx B: [115668]
    complexed with ate

Details for d1xnxb_

PDB Entry: 1xnx (more details), 2.9 Å

PDB Description: Crystal structure of constitutive androstane receptor

SCOP Domain Sequences for d1xnxb_:

Sequence, based on SEQRES records: (download)

>d1xnxb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus)}
qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv
qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda
vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema
lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgeic

Sequence, based on observed residues (ATOM records): (download)

>d1xnxb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus)}
qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv
qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda
vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema
lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrltpllgeic

SCOP Domain Coordinates for d1xnxb_:

Click to download the PDB-style file with coordinates for d1xnxb_.
(The format of our PDB-style files is described here.)

Timeline for d1xnxb_: