SCOP: Structural Classification of Proteins and ASTRAL. Release 1.71 (October 2006)
Search SCOP (example):

Lineage for d1xnxb_ (1xnx B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 protein domains)
  6. 543539Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 543545Species Mouse (Mus musculus) [TaxId:10090] [117015] (2 PDB entries)
  8. 543547Domain d1xnxb_: 1xnx B: [115668]
    complexed with ate

Details for d1xnxb_

PDB Entry: 1xnx (more details), 2.9 Å
PDB Description: crystal structure of constitutive androstane receptor

SCOP Domain Sequences for d1xnxb_:

Sequence, based on SEQRES records: (download)

>d1xnxb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus)}
qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv
qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda
vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema
lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgeic

Sequence, based on observed residues (ATOM records): (download)

>d1xnxb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus)}
qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv
qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda
vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema
lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrltpllgeic

SCOP Domain Coordinates for d1xnxb_:

Click to download the PDB-style file with coordinates for d1xnxb_.
(The format of our PDB-style files is described here.)

Timeline for d1xnxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xnxa_


SCOP Copyright © 1994-2009 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu