Domain d1xnxb_: 1xnx B:

Structural Classification of Proteins and ASTRAL release 1.71 (October 2006)

Lineage for d1xnxb_ (1xnx B:)

Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds)
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helices
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family)
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 protein domains)
Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
Species Mouse (Mus musculus) [TaxId:10090] [117015] (2 PDB entries)
Domain d1xnxb_: 1xnx B: [115668]
complexed with ate

Details for d1xnxb_

PDB Entry: 1xnx (more details)
PDB Description: crystal structure of constitutive androstane receptor

SCOP Domain Sequences for d1xnxb_:
Sequence, based on SEQRES records: (download)

>d1xnxb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus)} qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgeic

Sequence, based on observed residues (ATOM records): (download)

>d1xnxb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus)} qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrltpllgeic

SCOP Domain Coordinates for d1xnxb_:

Click to download the PDB-style file with coordinates for d1xnxb_.
(The format of our PDB-style files is described here.)

Timeline for d1xnxb_:
d1xnxb_ is new in SCOP 1.71
d1xnxb_ appears in SCOP 1.73

d1xnxb_
(click for larger image)

d1xnxb_ in context of chain

d1xnxb_ in context of PDB
Domains from other chains:
d1xnxa_