Lineage for d1xnxb_ (1xnx B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008834Protein Orphan nuclear receptor NR1I3 (CAR) [117014] (2 species)
  7. 2008840Species Mouse (Mus musculus) [TaxId:10090] [117015] (2 PDB entries)
    Uniprot O35627 109-358
  8. 2008842Domain d1xnxb_: 1xnx B: [115668]
    complexed with ate

Details for d1xnxb_

PDB Entry: 1xnx (more details), 2.9 Å

PDB Description: Crystal structure of constitutive androstane receptor
PDB Compounds: (B:) constitutive androstane receptor

SCOPe Domain Sequences for d1xnxb_:

Sequence, based on SEQRES records: (download)

>d1xnxb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]}
qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv
qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda
vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema
lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrleelsamtpllgeic

Sequence, based on observed residues (ATOM records): (download)

>d1xnxb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]}
qkelvqillgahtrhvgplfdqfvqfkppaylfmhhrpfqprgpvlpllthfadintfmv
qqiikftkdlplfrsltmedqisllkgaaveilhislnttfclqtenffcgplcykmeda
vhagfqyeflesilhfhknlkglhlqepeyvlmaatalfspdrpgvtqreeidqlqeema
lilnnhimeqqsrlqsrflyaklmglladlrsinnaysyelqrltpllgeic

SCOPe Domain Coordinates for d1xnxb_:

Click to download the PDB-style file with coordinates for d1xnxb_.
(The format of our PDB-style files is described here.)

Timeline for d1xnxb_: