Lineage for d1xnwf1 (1xnw F:10-267)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 690605Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 690606Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 690933Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 691012Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)
  7. 691026Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)
  8. 691057Domain d1xnwf1: 1xnw F:10-267 [115665]

Details for d1xnwf1

PDB Entry: 1xnw (more details), 2.6 Å

PDB Description: acyl-coa carboxylase beta subunit from s. coelicolor (pccb), apo form #2, mutant d422i
PDB Compounds: (F:) propionyl-CoA carboxylase complex B subunit

SCOP Domain Sequences for d1xnwf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnwf1 c.14.1.4 (F:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]}
dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
yvkqllsylpsnnlsepp

SCOP Domain Coordinates for d1xnwf1:

Click to download the PDB-style file with coordinates for d1xnwf1.
(The format of our PDB-style files is described here.)

Timeline for d1xnwf1: