Lineage for d1xnwd1 (1xnw D:10-267)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)
  7. Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)
    Uniprot Q9X4K7
  8. Domain d1xnwd1: 1xnw D:10-267 [115661]
    mutant

Details for d1xnwd1

PDB Entry: 1xnw (more details), 2.6 Å

PDB Description: Acyl-CoA Carboxylase Beta Subunit from S. coelicolor (PccB), apo form #2, mutant D422I
PDB Compounds: (D:) propionyl-CoA carboxylase complex B subunit

SCOPe Domain Sequences for d1xnwd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnwd1 c.14.1.4 (D:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]}
dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
yvkqllsylpsnnlsepp

SCOPe Domain Coordinates for d1xnwd1 are not available.

Timeline for d1xnwd1:

Domains from same chain:
(mouse over for more information)
d1xnwd2
Domains from other chains:
(mouse over for more information)
d1xnwa1, d1xnwa2, d1xnwb1, d1xnwb2, d1xnwc1, d1xnwc2, d1xnwe1, d1xnwe2, d1xnwf1, d1xnwf2