SCOP 1.71: Domain d1xnwb2: 1xnw B:268-530

Lineage for d1xnwb2 (1xnw B:268-530)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (4 proteins)
   Pfam 01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (1 species)

7. Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)

8. Domain d1xnwb2: 1xnw B:268-530 [115658]

Details for d1xnwb2

PDB Entry: 1xnw, 2.6 Å

PDB Description: acyl-coa carboxylase beta subunit from s. coelicolor (pccb), apo form #2, mutant d422i

SCOP Domain Sequences for d1xnwb2:

Sequence; same for both SEQRES and ATOM records:

>d1xnwb2 c.14.1.4 (B:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor}
afpeeadlavtdedaeldtivpdsanqpydmhsviehvlddaeffetqplfapniltgfg
rvegrpvgivanqpmqfagclditasekaarfvrtcdafnvpvltfvdvpgflpgvdqeh
dgiirrgaklifayaeatvplitvitrkafggayivmgskhlgadlnlawptaqiavmga
qgavnilhrrtiadagddaeatrarliqeyedallnpytaaergyvdavimpsdtrrhiv
rglrqlrtkreslppkkhgnipl

Timeline for d1xnwb2:

• d1xnwb2 is new in SCOP 1.71
  
• d1xnwb2 appears in SCOP 1.73
  
• d1xnwb2 appears in the current release, SCOPe 2.08