| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
| Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species) |
| Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries) Uniprot Q9X4K7 |
| Domain d1xnwb2: 1xnw B:268-530 [115658] mutant |
PDB Entry: 1xnw (more details), 2.6 Å
SCOPe Domain Sequences for d1xnwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnwb2 c.14.1.4 (B:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]}
afpeeadlavtdedaeldtivpdsanqpydmhsviehvlddaeffetqplfapniltgfg
rvegrpvgivanqpmqfagclditasekaarfvrtcdafnvpvltfvdvpgflpgvdqeh
dgiirrgaklifayaeatvplitvitrkafggayivmgskhlgadlnlawptaqiavmga
qgavnilhrrtiadagddaeatrarliqeyedallnpytaaergyvdavimpsdtrrhiv
rglrqlrtkreslppkkhgnipl
Timeline for d1xnwb2: