SCOP 1.73: Domain d1xnwb1: 1xnw B:10-267

Lineage for d1xnwb1 (1xnw B:10-267)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (6 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)

7. Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)

8. Domain d1xnwb1: 1xnw B:10-267 [115657]

Details for d1xnwb1

PDB Entry: 1xnw, 2.6 Å

PDB Description: acyl-coa carboxylase beta subunit from s. coelicolor (pccb), apo form #2, mutant d422i

PDB Compounds: (B:) propionyl-CoA carboxylase complex B subunit

SCOP Domain Sequences for d1xnwb1:

Sequence; same for both SEQRES and ATOM records:

>d1xnwb1 c.14.1.4 (B:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]}
dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
yvkqllsylpsnnlsepp

Timeline for d1xnwb1:

• d1xnwb1 first appeared in SCOP 1.71
  
• d1xnwb1 appears in SCOP 1.75
  
• d1xnwb1 appears in the current release, SCOPe 2.08