SCOPe 2.07: Domain d1xnwa1: 1xnw A:10-267

Lineage for d1xnwa1 (1xnw A:10-267)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
   Pfam PF01039
   the active site is formed by two different homologous subunits or domains of this fold

6. Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (3 species)

7. Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries)
   Uniprot Q9X4K7

8. Domain d1xnwa1: 1xnw A:10-267 [115655]
   mutant

Details for d1xnwa1

PDB Entry: 1xnw, 2.6 Å

PDB Description: acyl-coa carboxylase beta subunit from s. coelicolor (pccb), apo form #2, mutant d422i

PDB Compounds: (A:) propionyl-CoA carboxylase complex B subunit

SCOPe Domain Sequences for d1xnwa1:

Sequence; same for both SEQRES and ATOM records:

>d1xnwa1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]}
dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar
hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal
ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa
itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave
yvkqllsylpsnnlsepp

Timeline for d1xnwa1:

• d1xnwa1 first appeared in SCOP 1.71
  
• d1xnwa1 appears in SCOPe 2.06
  
• d1xnwa1 appears in the current release, SCOPe 2.08