![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (4 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (4 proteins) Pfam 01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein Propionyl-CoA carboxylase complex B subunit, PccB [117466] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [117467] (4 PDB entries) |
![]() | Domain d1xnwa1: 1xnw A:10-267 [115655] |
PDB Entry: 1xnw (more details), 2.6 Å
SCOP Domain Sequences for d1xnwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnwa1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor} dihttagkladlrrrieeathagsaravekqhakgkltareridllldegsfveldefar hrstnfgldanrpygdgvvtgygtvdgrpvavfsqdftvfggalgevygqkivkvmdfal ktgcpvvgindsggariqegvaslgaygeifrrnthasgvipqislvvgpcaggavyspa itdftvmvdqtshmfitgpdviktvtgedvgfeelggarthnstsgvahhmagdekdave yvkqllsylpsnnlsepp
Timeline for d1xnwa1: