Lineage for d1xnsa2 (1xns A:130-341)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737287Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 737288Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 737289Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 737290Protein Cre recombinase [56355] (1 species)
  7. 737291Species Bacteriophage P1 [TaxId:10678] [56356] (18 PDB entries)
  8. 737309Domain d1xnsa2: 1xns A:130-341 [115648]
    Other proteins in same PDB: d1xnsa1, d1xnsb1

Details for d1xnsa2

PDB Entry: 1xns (more details), 2.8 Å

PDB Description: Peptide trapped Holliday junction intermediate in Cre-loxP recombination
PDB Compounds: (A:) Recombinase cre

SCOP Domain Sequences for d1xnsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnsa2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOP Domain Coordinates for d1xnsa2:

Click to download the PDB-style file with coordinates for d1xnsa2.
(The format of our PDB-style files is described here.)

Timeline for d1xnsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xnsa1