| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) ![]() |
| Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins) |
| Protein Cre recombinase [56355] (1 species) |
| Species Bacteriophage P1 [TaxId:10678] [56356] (18 PDB entries) |
| Domain d1xnsa2: 1xns A:130-341 [115648] Other proteins in same PDB: d1xnsa1, d1xnsb1 |
PDB Entry: 1xns (more details), 2.8 Å
SCOP Domain Sequences for d1xnsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnsa2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled
Timeline for d1xnsa2: