Lineage for d1xnsa1 (1xns A:20-129)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 539305Fold a.60: SAM domain-like [47768] (14 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 539637Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) (S)
  5. 539638Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)
  6. 539639Protein Cre recombinase [47825] (1 species)
  7. 539640Species Bacteriophage P1 [TaxId:10678] [47826] (18 PDB entries)
  8. 539658Domain d1xnsa1: 1xns A:20-129 [115647]
    Other proteins in same PDB: d1xnsa2, d1xnsb2

Details for d1xnsa1

PDB Entry: 1xns (more details), 2.8 Å

PDB Description: Peptide trapped Holliday junction intermediate in Cre-loxP recombination

SCOP Domain Sequences for d1xnsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnsa1 a.60.9.1 (A:20-129) Cre recombinase {Bacteriophage P1}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

SCOP Domain Coordinates for d1xnsa1:

Click to download the PDB-style file with coordinates for d1xnsa1.
(The format of our PDB-style files is described here.)

Timeline for d1xnsa1:

Domains from same chain:
(mouse over for more information)
d1xnsa2
Domains from other chains:
(mouse over for more information)
d1xnsb1, d1xnsb2