Lineage for d1xnrs_ (1xnr S:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601336Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 601337Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 601338Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 601339Protein Ribosomal protein S19 [54572] (1 species)
  7. 601340Species Thermus thermophilus [TaxId:274] [54573] (20 PDB entries)
  8. 601347Domain d1xnrs_: 1xnr S: [115644]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrs_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

SCOP Domain Sequences for d1xnrs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrs_ d.28.1.1 (S:) Ribosomal protein S19 {Thermus thermophilus}
prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
itenmvghklgefaptrtyr

SCOP Domain Coordinates for d1xnrs_:

Click to download the PDB-style file with coordinates for d1xnrs_.
(The format of our PDB-style files is described here.)

Timeline for d1xnrs_: