Lineage for d1xnrr_ (1xnr R:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308916Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 2308917Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 2308918Protein Ribosomal protein S18 [46913] (2 species)
  7. 2308944Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 2308951Domain d1xnrr_: 1xnr R: [115643]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrr_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center
PDB Compounds: (R:) 16S Ribosomal protein S18

SCOPe Domain Sequences for d1xnrr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOPe Domain Coordinates for d1xnrr_:

Click to download the PDB-style file with coordinates for d1xnrr_.
(The format of our PDB-style files is described here.)

Timeline for d1xnrr_: