Lineage for d1xnrr_ (1xnr R:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 534044Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 534045Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 534046Protein Ribosomal protein S18 [46913] (1 species)
  7. 534047Species Thermus thermophilus [TaxId:274] [46914] (19 PDB entries)
  8. 534054Domain d1xnrr_: 1xnr R: [115643]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrr_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

SCOP Domain Sequences for d1xnrr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1xnrr_:

Click to download the PDB-style file with coordinates for d1xnrr_.
(The format of our PDB-style files is described here.)

Timeline for d1xnrr_: