SCOP 1.71: Domain d1xnro_: 1xnr O:

Lineage for d1xnro_ (1xnr O:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit

6. Protein Ribosomal protein S15 [47065] (2 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (23 PDB entries)

8. Domain d1xnro_: 1xnr O: [115640]
   Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
   complexed with mg, par, zn

Details for d1xnro_

PDB Entry: 1xnr, 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

SCOP Domain Sequences for d1xnro_:

Sequence; same for both SEQRES and ATOM records:

>d1xnro_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

Timeline for d1xnro_:

• d1xnro_ is new in SCOP 1.71
  
• d1xnro_ appears in SCOP 1.73
  
• d1xnro_ appears in the current release, SCOPe 2.08