Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) |
Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
Protein Ribosomal protein S10 [55001] (2 species) |
Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries) Uniprot P80375 |
Domain d1xnrj_: 1xnr J: [115635] Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_ complexed with mg, par, zn |
PDB Entry: 1xnr (more details), 3.1 Å
SCOPe Domain Sequences for d1xnrj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnrj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]} kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d1xnrj_: