Lineage for d1xnri_ (1xnr I:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598221Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 598259Protein Ribosomal protein S9 [54218] (1 species)
  7. 598260Species Thermus thermophilus [TaxId:274] [54219] (18 PDB entries)
  8. 598267Domain d1xnri_: 1xnr I: [115634]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnri_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center

SCOP Domain Sequences for d1xnri_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnri_ d.14.1.1 (I:) Ribosomal protein S9 {Thermus thermophilus}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOP Domain Coordinates for d1xnri_:

Click to download the PDB-style file with coordinates for d1xnri_.
(The format of our PDB-style files is described here.)

Timeline for d1xnri_: