Lineage for d1xnrc2 (1xnr C:107-207)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722852Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 722853Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 722854Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 722855Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 722856Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
  8. 722861Domain d1xnrc2: 1xnr C:107-207 [115627]
    Other proteins in same PDB: d1xnrb_, d1xnrc1, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrc2

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center
PDB Compounds: (C:) 16S Ribosomal protein S3

SCOP Domain Sequences for d1xnrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1xnrc2:

Click to download the PDB-style file with coordinates for d1xnrc2.
(The format of our PDB-style files is described here.)

Timeline for d1xnrc2: