Lineage for d1xnrb_ (1xnr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858664Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 2858665Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 2858666Protein Ribosomal protein S2 [52315] (3 species)
  7. 2858703Species Thermus thermophilus [TaxId:274] [52316] (46 PDB entries)
    Uniprot P80371
  8. 2858709Domain d1xnrb_: 1xnr B: [115625]
    Other proteins in same PDB: d1xnrc1, d1xnrc2, d1xnrd_, d1xnre1, d1xnre2, d1xnrf_, d1xnrg_, d1xnrh_, d1xnri_, d1xnrj_, d1xnrk_, d1xnrl_, d1xnrm_, d1xnrn_, d1xnro_, d1xnrp_, d1xnrq_, d1xnrr_, d1xnrs_, d1xnrt_, d1xnrv_
    complexed with mg, par, zn

Details for d1xnrb_

PDB Entry: 1xnr (more details), 3.1 Å

PDB Description: Crystal Structure of an Inosine-Cytosine Wobble Base Pair in the Context of the Decoding Center
PDB Compounds: (B:) 16S Ribosomal protein S2

SCOPe Domain Sequences for d1xnrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnrb_ c.23.15.1 (B:) Ribosomal protein S2 {Thermus thermophilus [TaxId: 274]}
vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq

SCOPe Domain Coordinates for d1xnrb_:

Click to download the PDB-style file with coordinates for d1xnrb_.
(The format of our PDB-style files is described here.)

Timeline for d1xnrb_: