SCOPe 2.02: Domain d1xnqt_: 1xnq T:

Lineage for d1xnqt_ (1xnq T:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family)

5. Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
   this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain

6. Protein Ribosomal protein S20 [46994] (2 species)

7. Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
   Uniprot P80380

8. Domain d1xnqt_: 1xnq T: [115623]
   Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqv_
   complexed with mg, par, zn

Details for d1xnqt_

PDB Entry: 1xnq, 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

PDB Compounds: (T:) ribosomal protein s20

SCOPe Domain Sequences for d1xnqt_:

Sequence; same for both SEQRES and ATOM records:

>d1xnqt_ a.7.6.1 (T:) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

Timeline for d1xnqt_:

• d1xnqt_ first appeared in SCOP 1.71
  
• d1xnqt_ appears in SCOPe 2.01
  
• d1xnqt_ appears in SCOPe 2.03
  
• d1xnqt_ appears in the current release, SCOPe 2.08