Lineage for d1xnqr_ (1xnq R:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 534044Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 534045Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 534046Protein Ribosomal protein S18 [46913] (1 species)
  7. 534047Species Thermus thermophilus [TaxId:274] [46914] (19 PDB entries)
  8. 534053Domain d1xnqr_: 1xnq R: [115621]
    Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqs_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqr_

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

SCOP Domain Sequences for d1xnqr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqr_ a.4.8.1 (R:) Ribosomal protein S18 {Thermus thermophilus}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1xnqr_:

Click to download the PDB-style file with coordinates for d1xnqr_.
(The format of our PDB-style files is described here.)

Timeline for d1xnqr_: