Lineage for d1xnqg_ (1xnq G:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772539Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 772540Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 772541Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 772542Protein Ribosomal protein S7 [47975] (4 species)
  7. 772572Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 772585Domain d1xnqg_: 1xnq G: [115610]
    Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqg_

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center
PDB Compounds: (G:) ribosomal protein s7

SCOP Domain Sequences for d1xnqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqg_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOP Domain Coordinates for d1xnqg_:

Click to download the PDB-style file with coordinates for d1xnqg_.
(The format of our PDB-style files is described here.)

Timeline for d1xnqg_: