Lineage for d1xnqf_ (1xnq F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206291Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1206292Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1206293Protein Ribosomal protein S6 [54997] (4 species)
  7. 1206323Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 1206340Domain d1xnqf_: 1xnq F: [115609]
    Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqf_

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center
PDB Compounds: (F:) ribosomal protein s6

SCOPe Domain Sequences for d1xnqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqf_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d1xnqf_:

Click to download the PDB-style file with coordinates for d1xnqf_.
(The format of our PDB-style files is described here.)

Timeline for d1xnqf_: