Lineage for d1xnqd_ (1xnq D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912489Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 1912490Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 1912491Family d.66.1.2: Ribosomal protein S4 (bacteria) [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 1912492Protein Ribosomal protein S4 [55179] (3 species)
    also contains a Zn-binding N-terminal subdomain
  7. 1912523Species Thermus thermophilus [TaxId:274] [55180] (45 PDB entries)
  8. 1912535Domain d1xnqd_: 1xnq D: [115606]
    Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqc2, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
    complexed with mg, par, zn

Details for d1xnqd_

PDB Entry: 1xnq (more details), 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center
PDB Compounds: (D:) ribosomal protein s4

SCOPe Domain Sequences for d1xnqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnqd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus [TaxId: 274]}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOPe Domain Coordinates for d1xnqd_:

Click to download the PDB-style file with coordinates for d1xnqd_.
(The format of our PDB-style files is described here.)

Timeline for d1xnqd_: