SCOP 1.73: Domain d1xnqc2: 1xnq C:107-207

Lineage for d1xnqc2 (1xnq C:107-207)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)

8. Domain d1xnqc2: 1xnq C:107-207 [115605]
   Other proteins in same PDB: d1xnqb_, d1xnqc1, d1xnqd_, d1xnqe1, d1xnqe2, d1xnqf_, d1xnqg_, d1xnqh_, d1xnqi_, d1xnqj_, d1xnqk_, d1xnql_, d1xnqm_, d1xnqn_, d1xnqo_, d1xnqp_, d1xnqq_, d1xnqr_, d1xnqs_, d1xnqt_, d1xnqv_
   complexed with mg, par, zn

Details for d1xnqc2

PDB Entry: 1xnq, 3.05 Å

PDB Description: Structure of an Inosine-Adenine Wobble Base Pair Complex in the Context of the Decoding Center

PDB Compounds: (C:) ribosomal protein s3

SCOP Domain Sequences for d1xnqc2:

Sequence; same for both SEQRES and ATOM records:

>d1xnqc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

Timeline for d1xnqc2:

• d1xnqc2 first appeared in SCOP 1.71
  
• d1xnqc2 appears in SCOP 1.75
  
• d1xnqc2 appears in the current release, SCOPe 2.08