Lineage for d1xnii1 (1xni I:1485-1537)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311123Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1311124Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 1311155Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 1311156Species Human (Homo sapiens) [TaxId:9606] [110164] (4 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. 1311177Domain d1xnii1: 1xni I:1485-1537 [115598]

Details for d1xnii1

PDB Entry: 1xni (more details), 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1
PDB Compounds: (I:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d1xnii1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnii1 b.34.9.1 (I:1485-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

SCOPe Domain Coordinates for d1xnii1:

Click to download the PDB-style file with coordinates for d1xnii1.
(The format of our PDB-style files is described here.)

Timeline for d1xnii1: