| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (9 proteins) Pfam PF00567 |
| Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species) protein duplication: contains two Tudor domains in tandem |
| Species Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries) Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606 |
| Domain d1xnih1: 1xni H:1485-1537 [115596] Other proteins in same PDB: d1xnia2, d1xnib2, d1xnic2, d1xnid2, d1xnie2, d1xnif2, d1xnig2, d1xnih2, d1xnii2, d1xnij2 |
PDB Entry: 1xni (more details), 2.8 Å
SCOPe Domain Sequences for d1xnih1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xnih1 b.34.9.1 (H:1485-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp
Timeline for d1xnih1: