Lineage for d1xnig2 (1xni G:1538-1602)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796957Superfamily b.34.9: Tudor/PWWP/MBT [63748] (4 families) (S)
  5. 796958Family b.34.9.1: Tudor domain [63749] (7 proteins)
    Pfam PF00567
  6. 796988Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 796989Species Human (Homo sapiens) [TaxId:9606] [110164] (4 PDB entries)
    Uniprot Q12888 1485-1602
    Uniprot Q12888 1484-1606
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. 797007Domain d1xnig2: 1xni G:1538-1602 [115595]

Details for d1xnig2

PDB Entry: 1xni (more details), 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1
PDB Compounds: (G:) tumor suppressor p53-binding protein 1

SCOP Domain Sequences for d1xnig2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnig2 b.34.9.1 (G:1538-1602) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqygl

SCOP Domain Coordinates for d1xnig2:

Click to download the PDB-style file with coordinates for d1xnig2.
(The format of our PDB-style files is described here.)

Timeline for d1xnig2: