SCOP 1.75: Domain d1xnig1: 1xni G:1485-1537

Lineage for d1xnig1 (1xni G:1485-1537)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (4 families)

5. Family b.34.9.1: Tudor domain [63749] (7 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1 [110163] (1 species)
   duplication; contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [110164] (4 PDB entries)
   Uniprot Q12888 1485-1602
   Uniprot Q12888 1484-1606
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d1xnig1: 1xni G:1485-1537 [115594]

Details for d1xnig1

PDB Entry: 1xni, 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1

PDB Compounds: (G:) tumor suppressor p53-binding protein 1

SCOP Domain Sequences for d1xnig1:

Sequence; same for both SEQRES and ATOM records:

>d1xnig1 b.34.9.1 (G:1485-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

Timeline for d1xnig1:

• d1xnig1 first appeared in SCOP 1.71
  
• d1xnig1 appears in SCOP 1.73
  
• d1xnig1 appears in SCOPe 2.01
  
• d1xnig1 appears in the current release, SCOPe 2.08