Lineage for d1xnig1 (1xni G:1485-1537)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species)
    protein duplication: contains two Tudor domains in tandem
  7. Species Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. Domain d1xnig1: 1xni G:1485-1537 [115594]
    Other proteins in same PDB: d1xnia2, d1xnib2, d1xnic2, d1xnid2, d1xnie2, d1xnif2, d1xnig2, d1xnih2, d1xnii2, d1xnij2

Details for d1xnig1

PDB Entry: 1xni (more details), 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1
PDB Compounds: (G:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d1xnig1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnig1 b.34.9.1 (G:1485-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sfvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

SCOPe Domain Coordinates for d1xnig1 are not available.

Timeline for d1xnig1:

Domains from same chain:
(mouse over for more information)
d1xnig2
Domains from other chains:
(mouse over for more information)
d1xnia1, d1xnia2, d1xnib1, d1xnib2, d1xnic1, d1xnic2, d1xnid1, d1xnid2, d1xnie1, d1xnie2, d1xnif1, d1xnif2, d1xnih1, d1xnih2, d1xnii1, d1xnii2, d1xnij1, d1xnij2