Lineage for d1xnif2 (1xni F:1538-1602)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394116Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2394117Family b.34.9.1: Tudor domain [63749] (8 proteins)
    Pfam PF00567
  6. 2394151Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 2394152Species Human (Homo sapiens) [TaxId:9606] [110164] (18 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. 2394218Domain d1xnif2: 1xni F:1538-1602 [115593]

Details for d1xnif2

PDB Entry: 1xni (more details), 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1
PDB Compounds: (F:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d1xnif2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnif2 b.34.9.1 (F:1538-1602) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqygl

SCOPe Domain Coordinates for d1xnif2:

Click to download the PDB-style file with coordinates for d1xnif2.
(The format of our PDB-style files is described here.)

Timeline for d1xnif2: