SCOPe 2.08: Domain d1xnie2: 1xni E:1538-1602

Lineage for d1xnie2 (1xni E:1538-1602)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.1: Tudor domain [63749] (9 proteins)
   Pfam PF00567

6. Protein p53-binding protein 1, 53BP1, C-terminal domain [418915] (1 species)
   protein duplication: contains two Tudor domains in tandem

7. Species Human (Homo sapiens) [TaxId:9606] [419339] (18 PDB entries)
   Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606

8. Domain d1xnie2: 1xni E:1538-1602 [115591]
   Other proteins in same PDB: d1xnia1, d1xnib1, d1xnic1, d1xnid1, d1xnie1, d1xnif1, d1xnig1, d1xnih1, d1xnii1, d1xnij1
   has additional insertions and/or extensions that are not grouped together

Details for d1xnie2

PDB Entry: 1xni, 2.8 Å

PDB Description: Tandem Tudor Domain of 53BP1

PDB Compounds: (E:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d1xnie2:

Sequence; same for both SEQRES and ATOM records:

>d1xnie2 b.34.9.1 (E:1538-1602) p53-binding protein 1, 53BP1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqygl

Timeline for d1xnie2:

• d1xnie2 first appeared in SCOP 1.71
  
• d1xnie2 appears in SCOPe 2.07