SCOPe 2.04: Domain d1xnfb_: 1xnf B:

Lineage for d1xnfb_ (1xnf B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Lipoprotein NlpI [117009] (1 species)

7. Species Escherichia coli [TaxId:562] [117010] (1 PDB entry)
   Uniprot P39833 26-294

8. Domain d1xnfb_: 1xnf B: [115581]
   Structural genomics target
   complexed with trs

Details for d1xnfb_

PDB Entry: 1xnf, 1.98 Å

PDB Description: Crystal structure of E.coli TPR-protein NlpI

PDB Compounds: (B:) Lipoprotein nlpI

SCOPe Domain Sequences for d1xnfb_:

Sequence; same for both SEQRES and ATOM records:

>d1xnfb_ a.118.8.1 (B:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}
swrksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralar
ndfsqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyy
ggrdklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwni
vefylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklava
nnvhnfvehryallelsllgqd

Timeline for d1xnfb_:

• d1xnfb_ first appeared in SCOP 1.71
  
• d1xnfb_ appears in SCOPe 2.03
  
• d1xnfb_ appears in SCOPe 2.05
  
• d1xnfb_ appears in the current release, SCOPe 2.08