Lineage for d1xnfa_ (1xnf A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2339718Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2339719Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2339751Protein Lipoprotein NlpI [117009] (2 species)
  7. 2339752Species Escherichia coli [TaxId:562] [117010] (1 PDB entry)
    Uniprot P39833 26-294
  8. 2339753Domain d1xnfa_: 1xnf A: [115580]
    Structural genomics target
    complexed with trs

Details for d1xnfa_

PDB Entry: 1xnf (more details), 1.98 Å

PDB Description: Crystal structure of E.coli TPR-protein NlpI
PDB Compounds: (A:) Lipoprotein nlpI

SCOPe Domain Sequences for d1xnfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}
ksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralarndf
sqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyyggr
dklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwnivef
ylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklavannv
hnfvehryallelsllgqd

SCOPe Domain Coordinates for d1xnfa_:

Click to download the PDB-style file with coordinates for d1xnfa_.
(The format of our PDB-style files is described here.)

Timeline for d1xnfa_: