SCOPe 2.08: Domain d1xnfa_: 1xnf A:

Lineage for d1xnfa_ (1xnf A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Lipoprotein NlpI [117009] (2 species)

7. Species Escherichia coli [TaxId:562] [117010] (1 PDB entry)
   Uniprot P39833 26-294

8. Domain d1xnfa_: 1xnf A: [115580]
   Structural genomics target
   complexed with trs
   applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1xnfa_

PDB Entry: 1xnf, 1.98 Å

PDB Description: Crystal structure of E.coli TPR-protein NlpI

PDB Compounds: (A:) Lipoprotein nlpI

SCOPe Domain Sequences for d1xnfa_:

Sequence; same for both SEQRES and ATOM records:

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}
ksevlavplqptlqqevilarmeqilasraltdderaqllyergvlydslglralarndf
sqalairpdmpevfnylgiyltqagnfdaayeafdsvleldptynyahlnrgialyyggr
dklaqddllafyqddpndpfrslwlylaeqkldekqakevlkqhfeksdkeqwgwnivef
ylgniseqtlmerlkadatdntslaehlsetnfylgkyylslgdldsatalfklavannv
hnfvehryallelsllgqd

Timeline for d1xnfa_:

• d1xnfa_ first appeared in SCOP 1.71
  
• d1xnfa_ appears in SCOPe 2.07