Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) |
Family d.12.1.3: Ribosomal protein S24e [117786] (1 protein) Pfam PF01282 |
Protein Ribosomal protein S24e [117787] (4 species) |
Species Methanosarcina mazei [TaxId:2209] [117788] (1 PDB entry) Uniprot Q8PZ95 |
Domain d1xn9a_: 1xn9 A: [115578] Structural genomics target |
PDB Entry: 1xn9 (more details)
SCOPe Domain Sequences for d1xn9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xn9a_ d.12.1.3 (A:) Ribosomal protein S24e {Methanosarcina mazei [TaxId: 2209]} mdikiikdkknpllnrreldfivkyegstpsrndvrnklaamlnaplellviqrikteyg mqeskgyaklyedadrmkqveqeyvlkrnavpgsetegeea
Timeline for d1xn9a_: