Lineage for d1xn8a_ (1xn8 A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546322Fold a.229: Hypothetical protein YqbG [116914] (1 superfamily)
    core: 4 helices; bundle, right-handed twist; left-handed superhelix
  4. 546323Superfamily a.229.1: Hypothetical protein YqbG [116915] (1 family) (S)
  5. 546324Family a.229.1.1: Hypothetical protein YqbG [116916] (1 protein)
  6. 546325Protein Hypothetical protein YqbG [116917] (1 species)
  7. 546326Species Bacillus subtilis [TaxId:1423] [116918] (1 PDB entry)
  8. 546327Domain d1xn8a_: 1xn8 A: [115577]
    Structural genomics target

Details for d1xn8a_

PDB Entry: 1xn8 (more details)

PDB Description: solution structure of bacillus subtilis protein yqbg: the northeast structural genomics consortium target sr215

SCOP Domain Sequences for d1xn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn8a_ a.229.1.1 (A:) Hypothetical protein YqbG {Bacillus subtilis}
mllitpdelksysvfesvktrpdellkqdileatadiilkvghdfsdaeyiplpetvrla
llklsqfyalingdesiikgyttekigdysytlgdgsslqkpdvyalikdyvkpadpdle
gieakvrmrsi

SCOP Domain Coordinates for d1xn8a_:

Click to download the PDB-style file with coordinates for d1xn8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xn8a_: