Lineage for d1xn8a_ (1xn8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737881Fold a.229: Hypothetical protein YqbG [116914] (1 superfamily)
    core: 4 helices; bundle, right-handed twist; left-handed superhelix
  4. 2737882Superfamily a.229.1: Hypothetical protein YqbG [116915] (1 family) (S)
    automatically mapped to Pfam PF11436
  5. 2737883Family a.229.1.1: Hypothetical protein YqbG [116916] (1 protein)
  6. 2737884Protein Hypothetical protein YqbG [116917] (1 species)
  7. 2737885Species Bacillus subtilis [TaxId:1423] [116918] (2 PDB entries)
    Uniprot P45923
  8. 2737887Domain d1xn8a_: 1xn8 A: [115577]
    Structural genomics target

Details for d1xn8a_

PDB Entry: 1xn8 (more details)

PDB Description: solution structure of bacillus subtilis protein yqbg: the northeast structural genomics consortium target sr215
PDB Compounds: (A:) Hypothetical protein yqbG

SCOPe Domain Sequences for d1xn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn8a_ a.229.1.1 (A:) Hypothetical protein YqbG {Bacillus subtilis [TaxId: 1423]}
mllitpdelksysvfesvktrpdellkqdileatadiilkvghdfsdaeyiplpetvrla
llklsqfyalingdesiikgyttekigdysytlgdgsslqkpdvyalikdyvkpadpdle
gieakvrmrsi

SCOPe Domain Coordinates for d1xn8a_:

Click to download the PDB-style file with coordinates for d1xn8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xn8a_: