Class a: All alpha proteins [46456] (290 folds) |
Fold a.229: Hypothetical protein YqbG [116914] (1 superfamily) core: 4 helices; bundle, right-handed twist; left-handed superhelix |
Superfamily a.229.1: Hypothetical protein YqbG [116915] (1 family) automatically mapped to Pfam PF11436 |
Family a.229.1.1: Hypothetical protein YqbG [116916] (1 protein) |
Protein Hypothetical protein YqbG [116917] (1 species) |
Species Bacillus subtilis [TaxId:1423] [116918] (2 PDB entries) Uniprot P45923 |
Domain d1xn8a_: 1xn8 A: [115577] Structural genomics target |
PDB Entry: 1xn8 (more details)
SCOPe Domain Sequences for d1xn8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xn8a_ a.229.1.1 (A:) Hypothetical protein YqbG {Bacillus subtilis [TaxId: 1423]} mllitpdelksysvfesvktrpdellkqdileatadiilkvghdfsdaeyiplpetvrla llklsqfyalingdesiikgyttekigdysytlgdgsslqkpdvyalikdyvkpadpdle gieakvrmrsi
Timeline for d1xn8a_: