Lineage for d1xn7a_ (1xn7 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 634918Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) (S)
    contains a small beta-sheet (wing)
  5. 635878Family a.4.5.62: Hypothetical protein YhgG [116812] (1 protein)
  6. 635879Protein Hypothetical protein YhgG [116813] (1 species)
  7. 635880Species Escherichia coli [TaxId:562] [116814] (1 PDB entry)
  8. 635881Domain d1xn7a_: 1xn7 A: [115576]
    Structural genomics target

Details for d1xn7a_

PDB Entry: 1xn7 (more details)

PDB Description: solution structure of e.coli protein yhgg: the northeast structural genomics consortium target et95
PDB Compounds: (A:) Hypothetical protein yhgG

SCOP Domain Sequences for d1xn7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn7a_ a.4.5.62 (A:) Hypothetical protein YhgG {Escherichia coli [TaxId: 562]}
masliqvrdllalrgrmeaaqisqtlntpqpminamlqqlesmgkavriqeepdgclsgs
ckscpegkaclrewwalr

SCOP Domain Coordinates for d1xn7a_:

Click to download the PDB-style file with coordinates for d1xn7a_.
(The format of our PDB-style files is described here.)

Timeline for d1xn7a_: