![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.62: Hypothetical protein YhgG [116812] (2 proteins) automatically mapped to Pfam PF09012 |
![]() | Protein Hypothetical protein YhgG [116813] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [116814] (1 PDB entry) Uniprot P64638 |
![]() | Domain d1xn7a_: 1xn7 A: [115576] Structural genomics target |
PDB Entry: 1xn7 (more details)
SCOPe Domain Sequences for d1xn7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xn7a_ a.4.5.62 (A:) Hypothetical protein YhgG {Escherichia coli [TaxId: 562]} masliqvrdllalrgrmeaaqisqtlntpqpminamlqqlesmgkavriqeepdgclsgs ckscpegkaclrewwalr
Timeline for d1xn7a_: