Lineage for d1xn5a_ (1xn5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975805Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
    Pfam PF05146
  6. 2975818Protein Hypothetical protein BH1534 [118097] (1 species)
  7. 2975819Species Bacillus halodurans [TaxId:86665] [118098] (1 PDB entry)
    Uniprot Q9KCN5
  8. 2975820Domain d1xn5a_: 1xn5 A: [115574]
    Structural genomics target

Details for d1xn5a_

PDB Entry: 1xn5 (more details)

PDB Description: Solution Structure of Bacillus halodurans Protein BH1534: The Northeast Structural Genomics Consortium Target BhR29
PDB Compounds: (A:) BH1534 unknown conserved protein

SCOPe Domain Sequences for d1xn5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn5a_ d.129.3.5 (A:) Hypothetical protein BH1534 {Bacillus halodurans [TaxId: 86665]}
mtrlpdikkevrfnapiekvweavstseglafwfmendlkaetghhfhlqspfgpspcqv
tdverpiklsftwdtdgwsvtfhlkeeengtiftivhsgwkqgdtkvekagaesavvher
mdrgwhdlvnerlrqive

SCOPe Domain Coordinates for d1xn5a_:

Click to download the PDB-style file with coordinates for d1xn5a_.
(The format of our PDB-style files is described here.)

Timeline for d1xn5a_: