Lineage for d1xn4a_ (1xn4 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 580964Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 580965Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (1 family) (S)
  5. 580966Family c.33.1.3: Isochorismatase-like hydrolases [100948] (6 proteins)
  6. 580987Protein Ribonuclease MAR1 [110502] (2 species)
  7. 580990Species Leishmania major [TaxId:5664] [117499] (1 PDB entry)
  8. 580991Domain d1xn4a_: 1xn4 A: [115573]

Details for d1xn4a_

PDB Entry: 1xn4 (more details), 3.8 Å

PDB Description: putative mar1 ribonuclease from leishmania major

SCOP Domain Sequences for d1xn4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xn4a_ c.33.1.3 (A:) Ribonuclease MAR1 {Leishmania major}
srlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhelvpentkyivtehyp
kglgrivpgitlpqtahliektrfscivpqveelledvdnavvfgieghacilqtvadll
dmnkrvflpkdglgsqkktdfkaamklmgswspnceittsesillqmtkdamdpnfkkis
kllkeeppipl

SCOP Domain Coordinates for d1xn4a_:

Click to download the PDB-style file with coordinates for d1xn4a_.
(The format of our PDB-style files is described here.)

Timeline for d1xn4a_: