![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) ![]() |
![]() | Family c.33.1.3: Isochorismatase-like hydrolases [100948] (7 proteins) |
![]() | Protein Ribonuclease MAR1 [110502] (2 species) |
![]() | Species Leishmania major [TaxId:5664] [117499] (1 PDB entry) Uniprot Q4QGT7 # ! Structural genomics target |
![]() | Domain d1xn4a_: 1xn4 A: [115573] |
PDB Entry: 1xn4 (more details), 3.8 Å
SCOPe Domain Sequences for d1xn4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xn4a_ c.33.1.3 (A:) Ribonuclease MAR1 {Leishmania major [TaxId: 5664]} srlmphyskgktaflcvdlqeafskrienfancvfvanrlarlhelvpentkyivtehyp kglgrivpgitlpqtahliektrfscivpqveelledvdnavvfgieghacilqtvadll dmnkrvflpkdglgsqkktdfkaamklmgswspnceittsesillqmtkdamdpnfkkis kllkeeppipl
Timeline for d1xn4a_: