SCOP 1.73: Domain d1xmyb_: 1xmy B:

Lineage for d1xmyb_ (1xmy B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries)

8. Domain d1xmyb_: 1xmy B: [115570]
   complexed with 4rr, mg, zn

Details for d1xmyb_

PDB Entry: 1xmy, 2.4 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With (R)-Rolipram

PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOP Domain Sequences for d1xmyb_:

Sequence; same for both SEQRES and ATOM records:

>d1xmyb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
qpdaqdildtlednrnwyqsmip

Timeline for d1xmyb_:

• d1xmyb_ first appeared in SCOP 1.71
  
• d1xmyb_ appears in SCOP 1.75
  
• d1xmyb_ appears in the current release, SCOPe 2.08