Lineage for d1xmua_ (1xmu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736615Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2736616Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. 2736712Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2736716Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)
  7. 2736717Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries)
    Uniprot Q07343 324-667
  8. 2736742Domain d1xmua_: 1xmu A: [115562]
    complexed with mg, rof, zn

Details for d1xmua_

PDB Entry: 1xmu (more details), 2.3 Å

PDB Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With Roflumilast
PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4B

SCOPe Domain Sequences for d1xmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xmua_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]}
rfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissd
tfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaih
dvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtl
rkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadls
nptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhpl
wetwadlvqpdaqdildtlednrnwyqsmip

SCOPe Domain Coordinates for d1xmua_:

Click to download the PDB-style file with coordinates for d1xmua_.
(The format of our PDB-style files is described here.)

Timeline for d1xmua_: