![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Hypothetical protein AT1g77540 [118064] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [118065] (6 PDB entries) Uniprot Q8LEN2 |
![]() | Domain d1xmta_: 1xmt A: [115561] Structural genomics target complexed with br |
PDB Entry: 1xmt (more details), 1.15 Å
SCOPe Domain Sequences for d1xmta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ppkivwnegkrrfetedheafieykmrnngkvmdlvhtyvpsfkrglglashlcvaafeh asshsisiipscsyvsdtflprnpswkplihsevf
Timeline for d1xmta_: